Ephrin-B1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159211

Catalog No. NBP159211

Description

Ephrin-B1 Polyclonal antibody specifically detects Ephrin-B1 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Ephrin-B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EFL3, EFL-3, ELK ligand, Elk-L, ephrin-B1, LERK-2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 92%; Rat: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P98172
• Gene Symbols: EFNB1
• Immunogen: Synthetic peptides corresponding to EFNB1(ephrin-B1) The peptide sequence was selected from the middle region of EFNB1. Peptide sequence SRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSG.
• Quantity: 100 μL
• Research Discipline: Cellular Signaling, Neuroscience
• Gene ID (Entrez): 1947
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only