Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP16266820

EPHX4 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16266820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16266820 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP16266820 Supplier Novus Biologicals Supplier No. NBP16266820UL

Description

Rabbit Polyclonal Antibody

EPHX4 Polyclonal specifically detects EPHX4 in Human samples. It is validated for Western Blot.

Specifications

Antigen EPHX4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8IUS5
Gene Alias ABHD7, abhydrolase domain containing 7, Abhydrolase domain-containing protein 7, EC 3.3, EPHXRPEpoxide hydrolase-related protein, epoxide hydrolase 4, FLJ90341
Gene Symbols EPHX4
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ABHD7(abhydrolase domain containing 7) The peptide sequence was selected form the N terminal of ABHD7. Peptide sequence HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 253152
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.