epithelial Sodium Channel gamma Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25653225UL

Catalog No. NB394435

Description

epithelial Sodium Channel gamma Polyclonal specifically detects epithelial Sodium Channel gamma in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: epithelial Sodium Channel gamma
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: amiloride-sensitive epithelial sodium channel gamma subunit, amiloride-sensitive sodium channel gamma-subunit, BESC3, ENaC gamma subunit, ENaCG, ENaCgamma, Epithelial Na(+) channel subunit gamma, gamma-ENaC, gamma-NaCH, Nonvoltage-gated sodium channel 1 subunit gamma, PHA1, SCNEGamiloride-sensitive sodium channel subunit gamma, sodium channel, nonvoltage-gated 1, gamma
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6340
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: SCNN1G
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SEYGLQVILYINEEEYNPFLVSSTGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQ
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only