Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
epithelial Sodium Channel gamma Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | epithelial Sodium Channel gamma |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
epithelial Sodium Channel gamma Polyclonal specifically detects epithelial Sodium Channel gamma in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| epithelial Sodium Channel gamma | |
| Polyclonal | |
| Rabbit | |
| Human | |
| amiloride-sensitive epithelial sodium channel gamma subunit, amiloride-sensitive sodium channel gamma-subunit, BESC3, ENaC gamma subunit, ENaCG, ENaCgamma, Epithelial Na(+) channel subunit gamma, gamma-ENaC, gamma-NaCH, Nonvoltage-gated sodium channel 1 subunit gamma, PHA1, SCNEGamiloride-sensitive sodium channel subunit gamma, sodium channel, nonvoltage-gated 1, gamma | |
| SCNN1G | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 6340 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SEYGLQVILYINEEEYNPFLVSSTGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title