Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Epsilon 1 Tubulin Antibody, Novus Biologicals™

Epsilon 1 Tubulin Antibody, Novus Biologicals™
SDP

Catalog No. NBP15822320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15822320 20 μL
NBP158223 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15822320 Supplier Novus Biologicals Supplier No. NBP15822320UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Epsilon 1 Tubulin Polyclonal specifically detects Epsilon 1 Tubulin in Human, Drosophila samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Epsilon 1 Tubulin
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9UJT0
Gene Alias dJ142L7.2, Epsilon-tubulin, FLJ22589, FLJ44203, TUBEepsilon-tubulin, tubulin epsilon chain, tubulin, epsilon 1
Gene Symbols TUBE1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TUBE1(tubulin, epsilon 1) The peptide sequence was selected from the middle region of TUBE1. Peptide sequence HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, Cell Cycle and Replication, Cytoskeleton Markers, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 51175
Target Species Human, Drosophila
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.