Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ER alpha/NR3A1 Antibody, Novus Biologicals™
SDP

Catalog No. NB406844 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB406844 25ul
NBP184827 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB406844 Supplier Novus Biologicals Supplier No. NBP18482725UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody has been used in 2 publications

ER alpha/NR3A1 Polyclonal specifically detects ER alpha/NR3A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen ER alpha/NR3A1
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50, Knockdown Validated
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias ER, ER alpha, Era, ER-alpha, ESRESRA, Estradiol receptor, estrogen receptor, estrogen receptor 1, estrogen receptor alpha, estrogen receptor alpha delta 3*4,56,7*/819-2 isoform, estrogen receptor alpha delta 4 +49 isoform, estrogen receptor alpha delta 4*5,6,7*/654 isoform, NR3A1DKFZp686N23123, Nuclear receptor subfamily 3 group A member 1
Gene Symbols ESR1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTID
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Research Discipline Angiogenesis, Breast Cancer, Cancer, Cell Biology, Cell Cycle and Replication, Dendritic Cell Markers, GPCR, Neuroscience, Signal Transduction, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 2099
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.