Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ER alpha/NR3A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
$416.50 - $682.00
Specifications
Antigen | ER alpha/NR3A1 |
---|---|
Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50, Knockdown Validated |
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
ER alpha/NR3A1 Polyclonal specifically detects ER alpha/NR3A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
ER alpha/NR3A1 | |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
ER, ER alpha, Era, ER-alpha, ESRESRA, Estradiol receptor, estrogen receptor, estrogen receptor 1, estrogen receptor alpha, estrogen receptor alpha delta 3*4,56,7*/819-2 isoform, estrogen receptor alpha delta 4 +49 isoform, estrogen receptor alpha delta 4*5,6,7*/654 isoform, NR3A1DKFZp686N23123, Nuclear receptor subfamily 3 group A member 1 | |
ESR1 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50, Knockdown Validated | |
Polyclonal | |
Rabbit | |
Angiogenesis, Breast Cancer, Cancer, Cell Biology, Cell Cycle and Replication, Dendritic Cell Markers, GPCR, Neuroscience, Signal Transduction, Transcription Factors and Regulators | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
2099 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:FGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTID | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title