Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ERCC6L Antibody, Novus Biologicals™

ERCC6L Antibody, Novus Biologicals™
SDP

Catalog No. NBP156332 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP156332 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP156332 Supplier Novus Biologicals Supplier No. NBP156332
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

ERCC6L Polyclonal specifically detects ERCC6L in Human samples. It is validated for Western Blot.

Specifications

Antigen ERCC6L
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q2NKX8
Gene Alias ATP-dependent helicase ERCC6-like, DNA excision repair protein ERCC-6-like, EC 3.6.1, EC 3.6.4.12, excision repair cross-complementing rodent repair deficiency, complementationgroup 6-like, excision repair protein ERCC6-like, FLJ20105, MGC131695, PICHexcision repair cross-complementing rodent repair deficiency complementationgroup 6 - like, PLK1-interacting checkpoint helicase, SNF2/RAD54 family protein, Tumor antigen BJ-HCC-15
Gene Symbols ERCC6L
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ERCC6L Antibody(against the N terminal of ERCC6L. Peptide sequence GDLEEAFKLFNLAKDIFPNEKVLSRIQKIQEALEELAEQGDDEFTDVCNS.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 54821
Test Specificity Expected identity based on immunogen sequence: Rabbit: 92%; Equine: 85%; Rat: 78%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Rat, Pig, Bovine, Canine, Equine, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.