Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. eRF1 Antibody, Novus Biologicals™

eRF1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15756520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15756520 20 μL
NBP157565 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15756520 Supplier Novus Biologicals Supplier No. NBP15756520UL

Description

Rabbit Polyclonal Antibody

eRF1 Polyclonal specifically detects eRF1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen eRF1
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P62495
Gene Alias D5S1995, ERF1eRF1, eukaryotic peptide chain release factor subunit 1, Eukaryotic release factor 1, eukaryotic translation termination factor 1, polypeptide chain release factor 1, Protein Cl1, RF1ERF, sup45 (yeast omnipotent suppressor 45) homolog-like 1, SUP45L1, TB3-1MGC111066
Gene Symbols ETF1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ETF1 (eukaryotic translation termination factor 1) The peptide sequence was selected from the N terminal of ETF1)(50ug). Peptide sequence ISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKL.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2107
Test Specificity This product is specific to Subunit or Isoform: 1.
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.