Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ ERK1 Inhibitor Peptide Set

For use in research applications
Supplier: Novus Biologicals™ NBP229333
Specifications
Human, Mouse, Rat, Hamster, Rabbit, Xenopus | |
Inhibition of Erk activation | |
2 mg | |
3795 | |
Lyophilized |
ERK Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361 | |
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
ERK1 Inhibitor Peptide Set | |
ERK1 |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction