Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Specifications
Specifications
| Host Species | Human, Mouse, Rat, Hamster, Rabbit, Xenopus |
| Components | ERK Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361 |
| For Use With (Application) | Inhibition of Erk activation |
| Content And Storage | Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. |
| Quantity | 5 mg |
| Product Type | ERK1 Inhibitor Peptide Set |
| Molecular Weight (g/mol) | 3795 |
| Inhibitors | ERK1 |
| Form | Lyophilized |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?
