Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Custom Products and Services
  4. Custom Enzymes and Inhibitors
  5. Novus Biologicals™ ERK1 Inhibitor Peptide Set

Novus Biologicals™ ERK1 Inhibitor Peptide Set
SDP

Catalog No. NBP2293335 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
2 mg
5 mg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP2293335 5 mg
NBP229333 2 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP2293335 Supplier Novus Biologicals™ Supplier No. NBP2293335MG
Only null left
Add to Cart
Add to Cart

Description

For use in research applications

Specifications

Host Species Human, Mouse, Rat, Hamster, Rabbit, Xenopus
Components ERK Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
For Use With (Application) Inhibition of Erk activation
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Quantity 5 mg
Product Type ERK1 Inhibitor Peptide Set
Molecular Weight (g/mol) 3795
Inhibitors ERK1
Form Lyophilized

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.