ERMN Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156953

Catalog No. NBP156953

Description

ERMN Polyclonal specifically detects ERMN in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ERMN
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ERMIN, ermin, ERM-like protein, JNKIAA1189ermin, juxtanodin
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57471
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8TAM6-2
• Gene Symbols: ERMN
• Immunogen: Synthetic peptides corresponding to KIAA1189 The peptide sequence was selected from the middle region of KIAA1189. Peptide sequence RVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDIS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Sumatran orangutan: 100%; Human: 100%;.
• Target Species: Human, Rat, Canine, Guinea Pig, Rabbit
• Isotype: IgG