Invitrogen™ ERV3 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579219

Catalog No. PIPA579219

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell, 22RV1 whole cell, HEPG2 whole cell, SKOV whole cell, A431 whole cell, HT1080 whole cell.

Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. This endogenous envelope protein has lost its fusogenic properties. It can inhibit cell growth through decrease expression of cyclin B1 and increased expression of p21 in vitro.

Specifications

• Antigen: ERV3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: ERV3-1
• Gene Alias: endogenous retroviral sequence 3; endogenous retrovirus group 3 member 1; endogenous retrovirus group 3 member 1 Env polyprotein; endogenous retrovirus group 3, member 1; Envelope polyprotein; envR; ERV3; ERV3 envelope protein; ERV-3 envelope protein; ERV3-1; ERV3-1 envelope protein; ERVR; ERV-R; ERV-R envelope protein; HERVR; HERV-R; HERV-R envelope protein; HERV-R_7q21.2 provirus ancestral Env polyprotein; SU; Surface protein; TM; Transmembrane protein
• Host Species: Rabbit
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 2086
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: Q14264
• Gene Symbols: ERV3-1
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ERV31 (575-604aa LELDDEGKVIKEITAKIQKLAHIPVQTWKG).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov