ESAM Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198329

Catalog No. NBP198329

Description

ESAM Polyclonal specifically detects ESAM in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ESAM
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 2310008D05Rik, endothelial cell adhesion molecule, endothelial cell-selective adhesion molecule, HUEL (C4orf1)-interacting protein, LP4791 protein, W117m
• Host Species: Rabbit
• Molecular Weight of Antigen: 41 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_620411
• Gene Symbols: ESAM
• Immunogen: The immunogen for this antibody is ESAM - N-terminal region. Peptide sequence VTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 90952
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.