ESCO2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25853225UL

Catalog No. NB393404

Description

ESCO2 Polyclonal specifically detects ESCO2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ESCO2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: 2410004I17Rik, EC 2.3.1.-, ECO1 homolog 2, EFO2, Establishment of cohesion 1 homolog 2, establishment of cohesion 1 homolog 2 (S. cerevisiae), N-acetyltransferase ESCO2, RBS, Roberts syndrome
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ESCO2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTPRKRKQDSLKCDSLLHFTENLFPSPNKKHCFYQNSDKNEENLHCSQQEHFVLSALKTTEINRLPSANQGSPFKSALSTVSF
• Quantity: 25 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 157570
• Target Species: Human
• Isotype: IgG

For Research Use Only