Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ESX1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18021420UL
Description
ESX1 Polyclonal specifically detects ESX1 in Human, Mouse samples. It is validated for Western Blot.Specifications
ESX1 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_031983 | |
ESX1 | |
Synthetic peptide directed towards the N terminal of mouse ESX1. Peptide sequence MESHKKCPCCYCTDLKTFVGAVKEETLQDPQPSLSSTLLEGADYQENAES. | |
Protein A purified | |
RUO | |
80712 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ESX homeobox 1, ESX1LESX1R, ESX1-related protein, ESXR1homeobox protein ESX1, Extraembryonic, spermatogenesis, homeobox 1, extraembryonic, spermatogenesis, homeobox 1 homolog, extraembryonic, spermatogenesis, homeobox 1 homolog (mouse) | |
Rabbit | |
35 kDa | |
20 μL | |
Primary | |
Human, Mouse | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction