Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ESX1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $499.50

Specifications

Antigen	ESX1
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP18021420 View Documents View Product Certificates	Novus Biologicals NBP18021420UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP180214 View Documents View Product Certificates	Novus Biologicals NBP180214	100 μL	Each for $499.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

ESX1 Polyclonal specifically detects ESX1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	ESX1
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Accession No.	NP_031983
Gene ID (Entrez)	80712
Immunogen	Synthetic peptide directed towards the N terminal of mouse ESX1. Peptide sequence MESHKKCPCCYCTDLKTFVGAVKEETLQDPQPSLSSTLLEGADYQENAES.
Primary or Secondary	Primary
Molecular Weight of Antigen	35 kDa

Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Target Species	Human, Mouse
Gene Alias	ESX homeobox 1, ESX1LESX1R, ESX1-related protein, ESXR1homeobox protein ESX1, Extraembryonic, spermatogenesis, homeobox 1, extraembryonic, spermatogenesis, homeobox 1 homolog, extraembryonic, spermatogenesis, homeobox 1 homolog (mouse)
Gene Symbols	ESX1
Isotype	IgG
Purification Method	Protein A purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ESX1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents