ETFA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP184856

Catalog No. NBP184856

Description

ETFA Polyclonal specifically detects ETFA in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ETFA
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
• Gene Alias: alpha-ETF, electron transfer flavoprotein alpha-subunit, Electron transfer flavoprotein subunit alpha, mitochondrial, electron-transfer-flavoprotein, alpha polypeptide, EMA, GA2, glutaric aciduria II, MADD
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ETFA
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VDAGFVPNDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVADYGIVADLFKVVPEMTEILK
• Quantity: 0.1 mL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 2108
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only