Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ets-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP256897
Description
Ets-1 Polyclonal specifically detects Ets-1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
Ets-1 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1, ets protein, ETS-1, EWSR2, FLJ10768, p54, protein C-ets-1, v-ets avian erythroblastosis virus E2 oncogene homolog 1, v-ets avian erythroblastosis virus E26 oncogene homolog 1, v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
ETS1 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTS | |
100 μL | |
Cancer, Cell Cycle and Replication, Chromatin Research, Innate Immunity, Transcription Factors and Regulators | |
2113 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction