Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ets-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
| Antigen | Ets-1 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Ets-1 Polyclonal specifically detects Ets-1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| Ets-1 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Cell Cycle and Replication, Chromatin Research, Innate Immunity, Transcription Factors and Regulators | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 2113 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1, ets protein, ETS-1, EWSR2, FLJ10768, p54, protein C-ets-1, v-ets avian erythroblastosis virus E2 oncogene homolog 1, v-ets avian erythroblastosis virus E26 oncogene homolog 1, v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) | |
| ETS1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title