ETS1 associated protein II Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255948

Catalog No. NBP255948

Description

ETS1 associated protein II Polyclonal specifically detects ETS1 associated protein II in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ETS1 associated protein II
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: AD022, dJ30M3.3, EAP2, EAPII, EC 3.1.4.-, ETS1-associated protein 2, ETS1-associated protein II, MGC111021,5'-Tyr-DNA phosphodiesterase, MGC9099,5'-tyrosyl-DNA phosphodiesterase, TRAF and TNF receptor associated protein, TTRAPTRAF and TNF receptor-associated protein, Tyr-DNA phosphodiesterase 2, tyrosyl-DNA phosphodiesterase 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: TDP2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MQEAPESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQMNSNLGITAACKLRFDRIFFRAAAEEGHIIP
• Quantity: 100 μL
• Research Discipline: Signal Transduction, Transcription Factors and Regulators
• Gene ID (Entrez): 51567
• Target Species: Human
• Isotype: IgG

For Research Use Only