Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ETS1 associated protein II Antibody, Novus Biologicals™
SDP

Catalog No. NBP255948 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP255948 100 μL
NB394739 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP255948 Supplier Novus Biologicals Supplier No. NBP255948
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

ETS1 associated protein II Polyclonal specifically detects ETS1 associated protein II in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen ETS1 associated protein II
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias AD022, dJ30M3.3, EAP2, EAPII, EC 3.1.4.-, ETS1-associated protein 2, ETS1-associated protein II, MGC111021,5'-Tyr-DNA phosphodiesterase, MGC9099,5'-tyrosyl-DNA phosphodiesterase, TRAF and TNF receptor associated protein, TTRAPTRAF and TNF receptor-associated protein, Tyr-DNA phosphodiesterase 2, tyrosyl-DNA phosphodiesterase 2
Gene Symbols TDP2
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MQEAPESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQMNSNLGITAACKLRFDRIFFRAAAEEGHIIP
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Signal Transduction, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 51567
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.