Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ETS1 associated protein II Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | ETS1 associated protein II |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ETS1 associated protein II Polyclonal specifically detects ETS1 associated protein II in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| ETS1 associated protein II | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction, Transcription Factors and Regulators | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 51567 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MQEAPESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQMNSNLGITAACKLRFDRIFFRAAAEEGHIIP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| AD022, dJ30M3.3, EAP2, EAPII, EC 3.1.4.-, ETS1-associated protein 2, ETS1-associated protein II, MGC111021,5'-Tyr-DNA phosphodiesterase, MGC9099,5'-tyrosyl-DNA phosphodiesterase, TRAF and TNF receptor associated protein, TTRAPTRAF and TNF receptor-associated protein, Tyr-DNA phosphodiesterase 2, tyrosyl-DNA phosphodiesterase 2 | |
| TDP2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title