ETV1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25773125UL

Catalog No. NB393806

Description

ETV1 Polyclonal specifically detects ETV1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ETV1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: DKFZp781L0674, ER81ets variant gene 1, ETS translocation variant 1, ets variant 1, Ets-related protein 81, MGC104699, MGC120533, MGC120534
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ETV1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQEGFLAHPSRTEGCMFEKGPRQFYDDTCVVPE
• Quantity: 25 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 2115
• Target Species: Human
• Isotype: IgG

For Research Use Only