Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ETV1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP317710100UL
This item is not returnable.
View return policy
Description
ETV1 Polyclonal antibody specifically detects ETV1 in Human samples. It is validated for Western BlotSpecifications
| ETV1 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/ml | |
| DKFZp781L0674, ER81ets variant gene 1, ETS translocation variant 1, ets variant 1, Ets-related protein 81, MGC104699, MGC120533, MGC120534 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: TPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQ | |
| 100 μg | |
| Stem Cell Markers | |
| 2115 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction