Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ETV1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$343.50 - $573.00
Specifications
Antigen | ETV1 |
---|---|
Dilution | Western Blot 0.04-0.4 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
ETV1 Polyclonal antibody specifically detects ETV1 in Human samples. It is validated for Western BlotSpecifications
ETV1 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Stem Cell Markers | |
PBS, pH 7.2, 40% glycerol | |
2115 | |
IgG | |
Affinity purified |
Western Blot 0.04-0.4 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Human | |
DKFZp781L0674, ER81ets variant gene 1, ETS translocation variant 1, ets variant 1, Ets-related protein 81, MGC104699, MGC120533, MGC120534 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: TPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQ | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title