Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ETV2/ER71 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB125701 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB125701 100 μg
NB125702 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB125701 Supplier Novus Biologicals Supplier No. NBP310400100UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

ETV2/ER71 Polyclonal specifically detects ETV2/ER71 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen ETV2/ER71
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias ER71MGC129835, ETS translocation variant 2, ets variant 2, Ets-related protein 71, ETSRP71ets variant gene 2, MGC129834
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_031985). Peptide sequence MDLWNWDEASLQEVPPGDKLTGLGAEFGFYFPEVALQEDTPITPMNVEGC
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2116
Target Species Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.