ETV7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18069425UL

Catalog No. NB407444

Description

ETV7 Polyclonal specifically detects ETV7 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ETV7
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
• Gene Accession No.: Q9Y603
• Gene Symbols: ETV7
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIK
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ETS translocation variant 7, ets variant 7, ets variant gene 7 (TEL2 oncogene), TEL-2, TEL2 oncogene, TEL2ETS-related protein Tel2, TELBEts transcription factor TEL-2b, Tel-related Ets factor, transcription factor ets, transcription factor ETV7, Transcription factor Tel-2, TREF
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51513
• Target Species: Human
• Isotype: IgG

For Research Use Only