EXOC6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155430

Catalog No. NBP155430

Description

EXOC6 Polyclonal specifically detects EXOC6 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: EXOC6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp761I2124, EXOC6A, exocyst complex component 6, Exocyst complex component Sec15A, FLJ1125, FLJ11251, MGC33397, SEC15A, SEC15L1SEC15-like 1 (S. cerevisiae), SEC15L3, SEC15-like 1, SEC15-like protein 1, SEC15-like protein 3, SEC15LSEC15, Sec15p
• Host Species: Rabbit
• Molecular Weight of Antigen: 88 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: B3KXY5
• Gene Symbols: EXOC6
• Immunogen: Synthetic peptides corresponding to EXOC6(exocyst complex component 6) Antibody(against the N terminal of EXOC6. Peptide sequence MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54536
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG