Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

EXOC6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	EXOC6
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15543020 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15543020UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP155430 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP155430	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

EXOC6 Polyclonal specifically detects EXOC6 in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen	EXOC6
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	B3KXY5
Gene ID (Entrez)	54536
Immunogen	Synthetic peptides corresponding to EXOC6(exocyst complex component 6) Antibody(against the N terminal of EXOC6. Peptide sequence MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	DKFZp761I2124, EXOC6A, exocyst complex component 6, Exocyst complex component Sec15A, FLJ1125, FLJ11251, MGC33397, SEC15A, SEC15L1SEC15-like 1 (S. cerevisiae), SEC15L3, SEC15-like 1, SEC15-like protein 1, SEC15-like protein 3, SEC15LSEC15, Sec15p
Gene Symbols	EXOC6
Isotype	IgG
Molecular Weight of Antigen	88 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

EXOC6 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents