Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Exosome component 6 Antibody, Novus Biologicals™

Exosome component 6 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15750820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15750820 20 μL
NBP157508 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15750820 Supplier Novus Biologicals Supplier No. NBP15750820UL

Description

Rabbit Polyclonal Antibody

Exosome component 6 Polyclonal specifically detects Exosome component 6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Exosome component 6
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q5RKV6
Gene Alias EAP4, exosome component 6hMtr3, hMtr3p, homolog of yeast mRNA transport regulator 3, Mtr3 (mRNA transport regulator 3)-homolog, MTR3mRNA transport regulator 3 homolog, Mtr3p, p11exosome complex exonuclease MTR3
Gene Symbols EXOSC6
Host Species Rabbit
Immunogen Synthetic peptides corresponding to EXOSC6 (exosome component 6) The peptide sequence was selected from the N terminal of Exosome component 6. Peptide sequence MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAK.
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 118460
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.