Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. EYS/RP25 Antibody, Novus Biologicals™

EYS/RP25 Antibody, Novus Biologicals™
SDP

Catalog No. NBP190038 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP190038 0.1 mL
NB405658 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP190038 Supplier Novus Biologicals Supplier No. NBP190038
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 6 publications

EYS/RP25 Polyclonal specifically detects EYS/RP25 in Human, Zebrafish samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.

Specifications

Antigen EYS/RP25
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence Reported in scientific literature (PMID 27737822)., Immunohistochemistry-Paraffin 1:500 - 1:1000, Immunohistochemistry-Frozen Reported in the scientific literature (PMID: 30052645).
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias C6orf178, C6orf179, C6orf180, dJ22I17.2, dJ303F19.1, EGFL10, EGFL11, EGF-like-domain, multiple 10, EGF-like-domain, multiple 11, eyes shut homolog (Drosophila), protein spacemaker homolog
Gene Symbols EYS
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:CECTSGWTGQNCSEEINECDSDPCMNGGLCHESTIPGQFVCLCPPLYTGQFCHQRYNLCDLLHNPCR
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 346007
Test Specificity Specificity of human EYS/RP25 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Zebrafish
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.