Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. F-box protein 15/FBXO15 Antibody, Novus Biologicals™

F-box protein 15/FBXO15 Antibody, Novus Biologicals™
SDP

Catalog No. NBP1569020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1569020 20 μL
NBP156901 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1569020 Supplier Novus Biologicals Supplier No. NBP15690120UL

Description

Rabbit Polyclonal Antibody

F-box protein 15/FBXO15 Polyclonal specifically detects F-box protein 15/FBXO15 in Human samples. It is validated for Western Blot.

Specifications

Antigen F-box protein 15/FBXO15
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8NCQ5
Gene Alias F-box only protein 15, F-box protein 15, FBX15MGC39671
Gene Symbols FBXO15
Host Species Rabbit
Immunogen Synthetic peptides corresponding to FBXO15(F-box protein 15) The peptide sequence was selected from the N terminal of FBXO15. Peptide sequence QDKEAGYWKKEYITKQIASVKAALADILKPVNPYTGLPVKTKEALRIFGL.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 201456
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.