Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. FA2H Antibody, Novus Biologicals™

FA2H Antibody, Novus Biologicals™
SDP

Catalog No. NBP16892820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16892820 20 μL
NBP168928 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16892820 Supplier Novus Biologicals Supplier No. NBP16892820UL

Description

Rabbit Polyclonal Antibody

FA2H Polyclonal specifically detects FA2H in Mouse samples. It is validated for Western Blot.

Specifications

Antigen FA2H
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. Q5MPP0
Gene Alias FAAHFAXDC1, FAH1, fatty acid 2-hydroxylase, Fatty acid alpha-hydroxylase, fatty acid hydroxylase domain containing 1, FLJ25287, SCS7, spastic paraplegia 35 (autosomal recessive), SPG35
Gene Symbols FA2H
Host Species Rabbit
Immunogen Synthetic peptides corresponding to Fa2h (fatty acid 2-hydroxylase) The peptide sequence was selected from the C terminal of Fa2h. Peptide sequence HGQHHKAPFDGSRLVFPPVPASLVIAFFYVFLRLILPETVGGIIFAGGLL.
Molecular Weight of Antigen 43 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 79152
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.