FABP7/B-FABP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Supplier:  Novus Biologicals NBP18864825UL

Catalog No. NB431209

Description

FABP7/B-FABP Polyclonal specifically detects FABP7/B-FABP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FABP7/B-FABP
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: FABP7
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCK
• Quantity: 25 μL
• Research Discipline: Cell Cycle and Replication, Stem Cells
• Gene ID (Entrez): 2173
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.1mg/mL
• Dilution: Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:50-1:200
• Gene Alias: B-FABPDKFZp547J2313, BLBPMRG, Brain lipid-binding protein, Brain-type fatty acid-binding protein, FABPBbrain lipid binding protein, fatty acid binding protein 7, brain, Fatty acid-binding protein 7, fatty acid-binding protein, brain, Mammary-derived growth inhibitor related, mammary-derived growth inhibitor-related
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only