Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FABP7/B-FABP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
$382.00 - $610.00
Specifications
Antigen | FABP7/B-FABP |
---|---|
Concentration | 0.1mg/mL |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
FABP7/B-FABP Polyclonal specifically detects FABP7/B-FABP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
FABP7/B-FABP | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
B-FABPDKFZp547J2313, BLBPMRG, Brain lipid-binding protein, Brain-type fatty acid-binding protein, FABPBbrain lipid binding protein, fatty acid binding protein 7, brain, Fatty acid-binding protein 7, fatty acid-binding protein, brain, Mammary-derived growth inhibitor related, mammary-derived growth inhibitor-related | |
FABP7 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
0.1mg/mL | |
Polyclonal | |
Rabbit | |
Cell Cycle and Replication, Stem Cells | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
2173 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCK | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title