Factor VIII Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168934

Catalog No. NBP168934

Description

Factor VIII A2 domain Polyclonal specifically detects Factor VIII A2 domain in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Factor VIII A2 domain
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AHF, Antihemophilic factor, coagulation factor VIII, procoagulant component, coagulation factor VIIIc, DXS1253E, F8Ccoagulation factor VIII, factor VIII F8B, FVIII, HEMAF8B, Procoagulant component
• Host Species: Rabbit
• Molecular Weight of Antigen: 79 kDa
• Quantity: 100 μL
• Research Discipline: Cardiovascular Biology
• Gene ID (Entrez): 2157
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P00451
• Gene Symbols: F8
• Immunogen: Synthetic peptides corresponding to F8 (coagulation factor VIII, procoagulant component) The peptide sequence was selected from the C terminal of F8. Peptide sequence IMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQ.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Canine: 77%.
• Target Species: Human, Bovine, Canine, Equine, Rabbit, Sheep
• Isotype: IgG