Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Factor VIII Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | Factor VIII A2 domain |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Factor VIII A2 domain Polyclonal specifically detects Factor VIII A2 domain in Human samples. It is validated for Western Blot.Specifications
Factor VIII A2 domain | |
Polyclonal | |
Rabbit | |
P00451 | |
2157 | |
Synthetic peptides corresponding to F8 (coagulation factor VIII, procoagulant component) The peptide sequence was selected from the C terminal of F8. Peptide sequence IMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQ. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
AHF, Antihemophilic factor, coagulation factor VIII, procoagulant component, coagulation factor VIIIc, DXS1253E, F8Ccoagulation factor VIII, factor VIII F8B, FVIII, HEMAF8B, Procoagulant component | |
F8 | |
IgG | |
79 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title