Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FAHD2A Antibody, Novus Biologicals™
SDP

Catalog No. NBP254717 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP254717 100 μL
NB395285 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP254717 Supplier Novus Biologicals Supplier No. NBP254717
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

FAHD2A Polyclonal specifically detects FAHD2A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen FAHD2A
Applications Western Blot, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias CGI-105, EC 3.-, fumarylacetoacetate hydrolase domain containing 1, fumarylacetoacetate hydrolase domain containing 2A, fumarylacetoacetate hydrolase domain-containing protein 2A, MGC131995
Gene Symbols FAHD2A
Host Species Rabbit
Immunogen This antibody was developed against a Recombinant Protein corresponding to amino acids:KWPFQPSRDMRLVQFRAPHLVGPHLGLETGNGGGVINLNAFDPTLPKTMTQFLEQGEATLSVARRALAAQLPVLP
Purification Method Immunogen affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 51011
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.