Learn More
Description
Specifications
Specifications
| Antigen | FAHD2B |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | DKFZp434N062, EC 3.-, fumarylacetoacetate hydrolase domain containing 2B, fumarylacetoacetate hydrolase domain-containing protein 2B |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse FAHD2B (NP_083905). Peptide sequence VSQFVTLYPGDLLLTGTPPGVGMFRKPPVFLKKGDEVQCEIEELGVIINK |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
