Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM105A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15997920UL
Description
FAM105A Polyclonal specifically detects FAM105A in Human samples. It is validated for Western Blot.Specifications
FAM105A | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q9NUU6 | |
FAM105A | |
Synthetic peptides corresponding to FAM105A(family with sequence similarity 105, member A) The peptide sequence was selected from the middle region of FAM105A. Peptide sequence QYSFGPEKYTGSNVFGKLRKYVELLKTQWTEFNGIRDYHKRGSMCNTLFS. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
family with sequence similarity 105, member A, FLJ11127, FLJ43660, hypothetical protein LOC54491, NET20 | |
Rabbit | |
Affinity Purified | |
RUO | |
54491 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction