Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM105A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | FAM105A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15997920
![]() |
Novus Biologicals
NBP15997920UL |
20 μL |
Each for $206.00
|
|
|||||
NBP159979
![]() |
Novus Biologicals
NBP159979 |
100 μL |
Each for $487.50
|
|
|||||
Description
FAM105A Polyclonal specifically detects FAM105A in Human samples. It is validated for Western Blot.Specifications
FAM105A | |
Polyclonal | |
Rabbit | |
Q9NUU6 | |
54491 | |
Synthetic peptides corresponding to FAM105A(family with sequence similarity 105, member A) The peptide sequence was selected from the middle region of FAM105A. Peptide sequence QYSFGPEKYTGSNVFGKLRKYVELLKTQWTEFNGIRDYHKRGSMCNTLFS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
family with sequence similarity 105, member A, FLJ11127, FLJ43660, hypothetical protein LOC54491, NET20 | |
FAM105A | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title