FAM113A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155522

Catalog No. NBP155522

Description

FAM113A Polyclonal specifically detects FAM113A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FAM113A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: bA12M19.1, C20orf81, chromosome 20 open reading frame 81, DKFZp547L054, family with sequence similarity 113, member A, FLJ22376, hypothetical protein LOC64773, Sarcoma antigen NY-SAR-23
• Host Species: Rabbit
• Molecular Weight of Antigen: 52 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9H1Q7
• Gene Symbols: PCED1A
• Immunogen: Synthetic peptides corresponding to FAM113A(family with sequence similarity 113, member A) The peptide sequence was selected from the C terminal of FAM113A. Peptide sequence YPLPQPSPPPLFPPLPQDTPFFPGQPFPPHEFFNYNPVEDFSMPPHLGCG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 64773
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG