Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM113A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FAM113A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FAM113A Polyclonal specifically detects FAM113A in Human samples. It is validated for Western Blot.Specifications
FAM113A | |
Polyclonal | |
Rabbit | |
Q9H1Q7 | |
64773 | |
Synthetic peptides corresponding to FAM113A(family with sequence similarity 113, member A) The peptide sequence was selected from the C terminal of FAM113A. Peptide sequence YPLPQPSPPPLFPPLPQDTPFFPGQPFPPHEFFNYNPVEDFSMPPHLGCG. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
bA12M19.1, C20orf81, chromosome 20 open reading frame 81, DKFZp547L054, family with sequence similarity 113, member A, FLJ22376, hypothetical protein LOC64773, Sarcoma antigen NY-SAR-23 | |
PCED1A | |
IgG | |
52 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title