FAM119A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP183282

Catalog No. NBP183282

Description

FAM119A Polyclonal specifically detects FAM119A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FAM119A
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: EC 2.1.1.-, FAM119A, HCA557B, Hepatocellular carcinoma-associated antigen 557b, hypothetical protein LOC151194, LOC151194, member A, methyltransferase like 21A, MGC45373
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: METTL21A
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:EHLCSNHSVILLACRIRYERDNNFLAMLERQFIVRKVHYDPEKDVHIYEAQKRNQKEDL
• Quantity: 0.1 mL
• Research Discipline: Proteases & Other Enzymes
• Gene ID (Entrez): 151194
• Target Species: Human
• Isotype: IgG

For Research Use Only