FAM120A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238771

Catalog No. NBP238771

Description

FAM120A Polyclonal specifically detects FAM120A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FAM120A
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q9NZB2
• Gene Symbols: FAM120A
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FYPASAYPRHFGPVPPSQGRGRGFAGVCGFGGPYGETVATGPYRAFRVAAASGHCGAFSGSDSSRTSKSQGGVQPIP
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: C9orf10MGC133257, chromosome 9 open reading frame 10, constitutive coactivator of PPAR-gamma-like protein 1, DNA polymerase-transactivated protein 1, DNA polymerase-transactivated protein 5, DNAPTP1, DNAPTP5, family with sequence similarity 120A, KIAA0183MGC111527, OSSA, Oxidative stress-associated Src activator, Protein FAM120A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23196
• Target Species: Human
• Isotype: IgG