Learn More
Description
Specifications
Specifications
| Antigen | FAM127B |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | CXX1b, family with sequence similarity 127 member B, mammalian retrotransposon derived protein 8A, mammalian retrotransposon-derived 8A, MAR8A, protein FAM127B, retrotransposon Gag-like protein 8A, RTL8A, SIRH, Sushi-Ichi retrotransposon homolog 6 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM127B. Peptide sequence GRVQLMKALLAGPLRPAARRWRNPIPFPETFDGDTDRLPEFIVQTSSYMF |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
