FAM130A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25806425UL

Catalog No. NB393633

Description

FAM130A1 Polyclonal specifically detects FAM130A1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: FAM130A1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: C12ORF2, C12orf22, CSRNP-2, cysteine/serine-rich nuclear protein 2, cysteine-serine-rich nuclear protein 2, FAM130A1, family with sequence similarity 130, member A1, FLJ25576, Protein FAM130A1, TAIP12, TAIP-12chromosome 12 open reading frame 22, TGF-beta-induced apoptosis protein 12
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 81566
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CSRNP2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GVCILEEPLAVPEELCPGLTAPILIQAQLPPGSSVLCFTENSDHPTASTVNSPSYLNSGPLVYYQVEQRPVLGVKG
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only