FAM131C Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP179607	100 μL

Catalog No. NBP179607 Supplier Novus Biologicals Supplier No. NBP179607

Description

Rabbit Polyclonal Antibody

FAM131C Polyclonal specifically detects FAM131C in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FAM131C
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: NP_872429
• Gene Alias: C1orf117, family with sequence similarity 131, member C, FLJ36766, hypothetical protein LOC348487, RP11-5P18.9
• Gene Symbols: FAM131C
• Host Species: Rabbit
• Immunogen: Synthetic peptide directed towards the middle region of human FAM131CThe immunogen for this antibody is FAM131C. Peptide sequence RGRVAHLIEWKGWSAQPAGWELSPAEDEHYCCLPDELREARFAAGVAEQF.
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 348487
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 85%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only