FAM132B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Supplier:  Novus Biologicals NBP257732

Catalog No. NBP257732

Description

FAM132B Polyclonal specifically detects FAM132B in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Immunoprecipitation.

Specifications

• Antigen: FAM132B
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunoprecipitation
• Gene Alias: C1qTNF15, Complement C1q Tumor Necrosis Factor-Related Protein 15, CTRP15, ERFE, Erythroferrone, Family With Sequence Similarity 132, Member B, Myonectin, Protein FAM132B
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 151176
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence, Immunoprecipitation
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: FAM132B
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EPTAERAHSVDPRDAWMLFVRQSDKGVNGKKRSRGKAKKLKFGLPGP
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only