Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM134B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15992420UL
Description
FAM134B Polyclonal specifically detects FAM134B in Human samples. It is validated for Western Blot.Specifications
FAM134B | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q9H6L5 | |
FAM134B | |
Synthetic peptides corresponding to FAM134B(family with sequence similarity 134, member B) The peptide sequence was selected from the middle region of FAM134B. Peptide sequence DFGIGEYINQKKRERSEADKEKSHKDDSELDFSALCPKISLTVAAKELSV. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FAM134B protein, family with sequence similarity 134, member B, FLJ20152, FLJ22155, FLJ22179, HSAN2B, JK1 | |
Rabbit | |
Affinity Purified | |
RUO | |
54463 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction